PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.104340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 345aa    MW: 38444.4 Da    PI: 6.5773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.104340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ ++ +G g+W++ ++  g++R++k+c++rw +yl
   Cucsa.104340.1 14 KGPWTPEEDQKLIKHIQNHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.92e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
   Cucsa.104340.1  67 RGKFSQEEEQTILNLHSVLGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.815961IPR017930Myb domain
SuperFamilySSF466891.14E-3111108IPR009057Homeodomain-like
SMARTSM007174.5E-151363IPR001005SANT/Myb domain
PfamPF002493.5E-171461IPR001005SANT/Myb domain
CDDcd001675.73E-121661No hitNo description
PROSITE profilePS5129426.62762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2865117IPR009057Homeodomain-like
SMARTSM007179.8E-1766114IPR001005SANT/Myb domain
PfamPF002493.3E-1667112IPR001005SANT/Myb domain
CDDcd001672.55E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLIKHIQ NHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSVLGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHII ALASLKELME NPSWEEQALR LQAEALQMAK CQYLQYLLQP  180
PSLISNNNNP TEIDIMNLIN SLSSPLFENQ ISITQNNNNI NPPLQPLGTD SVSLLFSHLP  240
SLEVVPSNNT NTYETMPFIA KEMCSQNNEV CDANNNSPWQ LPFSSTAPSP PSVAPRMNII  300
NEGPSSNSNY GDACSSSSLG GSSSSIWPDH LLLEDALFHD IPSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143558.10.0PREDICTED: myb-related protein Hv1
SwissprotQ8GWP03e-72MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0A0KLW50.0A0A0A0KLW5_CUCSA; Uncharacterized protein
STRINGVIT_07s0141g00100.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-100myb domain protein 93